Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

EGF Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Epidermal Growth Factor, Urogastrone, URG
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG200630100 100 μg
RBG200631000 1mg
RBG200630500 500 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. This receptor also binds with TGF-α and VGF (vaccinia virus growth factor). Recombinant Murine EGF is a 6.0 kDa globular protein containing 53 amino acid residues, including 3 intramolecular disulfide bonds.

Amino Acid Sequence

NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Source

E. coli

Purity

98%

Biological Activity

The ED50 was determined by a cell proliferation assay using BALB/c 3T3 cells is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1×107 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.5–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease, Neural tissue markers, Oncology, Animal studies

Related Products Docs