Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

ENA-78 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Epithelial Neutrophil Activating Peptide-78, CXCL5, CXCL5
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10119005 5 µg
RBG10119020 20 µg
RBG10119100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

ENA-78 is a CXC chemokine that signals through the CXCR2 receptor. It is expressed in monocytes, platelets, endothelial cells, and mast cells. ENA-78 is a chemoattractant for neutrophils. Three N-terminal truncated variants of human ENA-78; ENA 5–78, ENA 8–78, ENA 9–78, contain 74, 71, and 70 amino acid residues, respectively, possess increased biological activity. ENA-78 contains the four conserved cysteine residues present in CXC chemokines, and also contains the ‘ELR’ motif common to CXC chemokine that bind to the CXCR1 and CXCR2 receptors. Recombinant Human ENA-78 is a 7.8 kDa protein consisting of 71 amino acid residues.

Amino Acid Sequence

LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human neutrophils using a concentration range of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Chemokines, Coronary artery disease, Cytokines and chemokines and related molecules

Related Products Docs