Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

ENA-78 Human E. coli (5-78 a.a.)

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Epithelial Neutrophil Activating Peptide-78, CXCL5, CXCL5
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10118005 5 µg
RBG10118020 20 µg
RBG10118100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

ENA-78 is a CXC chemokine that signals through the CXCR2 receptor. It is expressed in monocytes, platelets, endothelial cells, and mast cells. ENA-78 is a chemoattractant for neutrophils. The three naturally occurring variants of human ENA-78; ENA 5–78, ENA 9–78 and ENA 10–78, contain 74, 70, and 69 amino acid residues, respectively, and possess the same biological activity. ENA-78 contains the four conserved cysteine residues present in CXC chemokines, and also contains the ‘ELR’ motif common to CXC chemokine that bind to the CXCR1 and CXCR2 receptors. Recombinant Human ENA-78 is an 8.0 kDa protein consisting of 74 amino acid residues.

Amino Acid Sequence

AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration of 5.0–10.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Chemokines, Coronary artery disease, Cytokines and chemokines and related molecules

Related Products Docs