Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Endostatin Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10120020 20 µg
RBG10120100 100 μg
RBG10120250 250 µg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Endostatin is a naturally occurring 20 kDa polypeptide derived from the C-terminal portion of type XVIII collagen. It functions as an anti-angiogenic cytokine that is expressed in various organs, with the highest levels in liver, lung and kidney. Endostatin inhibits angiogenesis by blocking the pro-angiogenic activities of VEGF and FGF-basic. Recombinant Human Endostatin is a 20.2 kDa protein consisting of 184 amino acid residues.

Amino Acid Sequence

MHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK

Source

E. coli

Purity

98%

Biological Activity

Measured by its ability to inhibit HUVEC migration.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Oncology

Related Products Docs