Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Eotaxin-2 Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CCL24
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20065005 5 µg
RBG20065020 20 µg
RBG20065100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Eotaxin-2 is a CC chemokine that signals through the CCR3 receptor. It is produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3, including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Additionally, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. The mature protein, which also includes a C-terminal truncation, contains 78 amino acid residues (92 a.a. residues for the murine homolog, without C-terminal truncation). Eotaxin-2 contains the four conserved cysteine residues present in CC chemokines. Recombinant Murine Eotaxin-2 is a 10.3 kDa protein containing 93 amino acid residues.

Amino Acid Sequence

VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract murine lymphocytes using a concentration range of 10–100 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Animal studies

Related Products Docs