Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Eotaxin-3 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CCL26
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10124005 5 µg
RBG10124020 20 µg
RBG10124100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Eotaxin-3 is a CC chemokine that signals through the CCR3 receptor. It is produced by endothelial cells stimulated with IL-4 or IL-13. Eotaxin-3 selectively targets cells expressing CCR3, including eosinophils, basophils, T cells and monocytes. Eotaxin-3 has similar activity to Eotaxin and Eotaxin-2, but the three Eotaxins share only a low degree of sequence homology. Recombinant Human Eotaxin-3 is an 8.4 kDa protein containing 71 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines.

Amino Acid Sequence

TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human CCR3/HEK 293 cells. The maximum activity was achieved at 2 ug/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation

Related Products Docs