Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Eotaxin Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Small-inducible cytokine A11, Eosinophil chemotactic protein, Small inducible cytokine subfamily A (Cys-Cys), member 11, CCL11
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20064005 5 µg
RBG20064020 20 µg
RBG20064100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Eotaxin is a CC chemokine that signals through the CCR3 receptor. It is produced by IFN-γ-stimulated endothelial cells and TNF-activated monocytes. Eotaxin selectively chemoattracts eosinophils and, along with Eotaxin-2 and Eotaxin-3, plays a key role in the regulation of eosinophil recruitment in the asthmatic lung and in allergic reactions. Recombinant Murine Eotaxin is an 8.4 kDa protein containing 74 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines.

Amino Acid Sequence

HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP

Source

E. coli

Purity

98%

Biological Activity

Murine Eotaxin was found to induce chemotaxis of purified eosinophils at concentrations ranging between 100–1000 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation, Animal studies

Summary

Eotaxin, also known as CCL11, is a member of the CC chemokine family of inflammatory and immunoregulatory cytokines. Constitutive Eotaxin mRNA expression has been detected in multiple tissues, most often it appears to be induced by inflammatory cytokines such as IL-1, TNFα and IFNγ in fibroblasts, endothelial and epithelial cells. Following allergen challenge Eotaxin mRNA has been shown to be rapidly up-regulated in airway epithelium an alveolar macrophages. Eotaxin expression has also been detected in smooth muscle cells, chondrocytes and eosinophils. Mouse Eotaxin activity is mediated by the mouse CC chemokine receptor CCR3, which, unlike human CCR3, can also be activated by mouse MIP-1α. Among CC chemokine familiy members, Eotaxin is functionally and structurally mostly related to the MCP/Eotaxin proteins. Mouse Eotaxin cDNA encodes a 97 amino acid residue precursor protein that is cleaved to generate the 74 aa residue mature protein. Mouse Eotaxin has been shown to be a potent chemoattractant for eosinophils during inflammation and allergic reactions and to be involved in the growth of myeloid cell progenitors and the differentiation of mast cells during embryonic development. A role in numerous eosinophil-associated gastrointestinals disorders as food allergy, parasitic infections, allergic colitis and inflammatory Bowel disease has been described.

Related Products Docs