Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Epidermal Fatty Acid Binding Protein Human E. coli Tag free

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:FABP5, Fatty acid-binding protein epidermal, Epidermal-type fatty acid-binding protein, E-FABP, Fatty acid-binding protein 5, Psoriasis-associated fatty acid-binding protein homolog, PA-FABP
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172060100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 135 AA. MW: 15.2 kDa (calculated). UniProtKB acc.no. Q01469. 134 AA and one extra AA, N-terminal methionin (highlighted).

Amino Acid Sequence

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 90%

SDS-PAGE Gel

14% SDS-PAGE separation of Human EFABP
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in phosphate buffered saline

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store lyophilized protein at –80°C. Lyophilized protein remains stable until the expiry date when stored at –80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Cardiovascular disease, Diabetology - Other Relevant Products, Energy metabolism and body weight regulation, Oncology

Summary

Human fatty acid binding protein EFABP is a 15 kD member of the intracellular fatty acid binding protein (FABP) family, which is known for the ability to bind fatty acids and related compounds ( bile acids or retinoids). in an internal cavity. The fatty acid binding proteins aP2 (fatty acid binding protein [FABP]-4) and mal1 (EFABP) are closely related and both are expressed in adipocytes. Absence of EFABP/mal1 resulted in increased systemic insulin sensitivity in two models of obesity and insulin resistance. Adipocytes isolated from mal1-deficient mice also exhibited enhanced insulin-stimulated glucose transport capacity. In contrast, mice expressing high levels of mal1 in adipose tissue display reduced systemic insulin sensitivity .

Product References (4)

References

  • Haider DG, Schindler K, Bohdjalian A, Prager G, Luger A, Wolzt M, Ludvik B.Plasma adipocyte and epidermal fatty acid binding protein is reduced after weightloss in obesity. Diabetes Obes Metab. 2007 Sep;9(5):761-3. Epub 2007 Mar 13.PubMed PMID: 17359244. See more on PubMed
  • Housova J, Anderlova K, Krizová J, Haluzikova D, Kremen J, Kumstyrová T,Papezová H, Haluzik M. Serum adiponectin and resistin concentrations in patients with restrictive and binge/purge form of anorexia nervosa and bulimia nervosa. J Clin Endocrinol Metab. 2005 Mar;90(3):1366-70. Epub 2004 Dec 14. PubMed PMID:15598689. See more on PubMed
  • Stejskal D, Karpisek M. Adipocyte fatty acid binding protein in a Caucasianpopulation: a new marker of metabolic syndrome? Eur J Clin Invest. 2006Sep;36(9):621-5. PubMed PMID: 16919044. See more on PubMed
  • Yeung DC, Wang Y, Xu A, Cheung SC, Wat NM, Fong DY, Fong CH, Chau MT, Sham PC,Lam KS. Epidermal fatty-acid-binding protein: a new circulating biomarkerassociated with cardio-metabolic risk factors and carotid atherosclerosis. EurHeart J. 2008 Sep;29(17):2156-63. doi: 10.1093/eurheartj/ehn295. Epub 2008 Jul 4.PubMed PMID: 18603624. See more on PubMed
Summary References (7)

References to Epidermal Fatty Acid Binding Protein

  • Fisher RM, Eriksson P, Hoffstedt J, Hotamisligil GS, Thorne A, Ryden M, Hamsten A, Arner P. Fatty acid binding protein expression in different adipose tissue depots from lean and obese individuals. Diabetologia. 2001 Oct;44 (10):1268-73
  • Fisher RM, Hoffstedt J, Hotamisligil GS, Thorne A, Ryden M. Effects of obesity and weight loss on the expression of proteins involved in fatty acid metabolism in human adipose tissue. Int J Obes Relat Metab Disord. 2002 Oct;26 (10):1379-85
  • Haunerland NH, Spener F. Fatty acid-binding proteins--insights from genetic manipulations. Prog Lipid Res. 2004 Jul;43 (4):328-49
  • Hertzel AV, Bennaars-Eiden A, Bernlohr DA. Increased lipolysis in transgenic animals overexpressing the epithelial fatty acid binding protein in adipose cells. J Lipid Res. 2002 Dec;43 (12):2105-11
  • Jenkins-Kruchten AE, Bennaars-Eiden A, Ross JR, Shen WJ, Kraemer FB, Bernlohr DA. Fatty acid-binding protein-hormone-sensitive lipase interaction. Fatty acid dependence on binding. J Biol Chem. 2003 Nov 28;278 (48):47636-43
  • Maeda K, Cao H, Kono K, Gorgun CZ, Furuhashi M, Uysal KT, Cao Q, Atsumi G, Malone H, Krishnan B, Minokoshi Y, Kahn BB, Parker RA, Hotamisligil GS. Adipocyte/macrophage fatty acid binding proteins control integrated metabolic responses in obesity and diabetes. Cell Metab. 2005 Feb;1 (2):107-19
  • Makowski L, Hotamisligil GS. The role of fatty acid binding proteins in metabolic syndrome and atherosclerosis. Curr Opin Lipidol. 2005 Oct;16 (5):543-8
Related Products Docs