Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Epigen Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:EPG, Epithelial mitogen
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10125005 5 µg
RBG10125025 25 µg
RBG10125100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, and heart, as well as in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated 14.7 kDa transmembrane precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence. Recombinant Human Epigen is a 7.9 kDa monomeric protein, containing 72 amino acid residues, which comprises the EGF-homologous portion of the Epigen precursor.

Amino Acid Sequence

AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA

Source

E. coli

Purity

98%

Biological Activity

Determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells. The expected ED50 for this effect is 150–300ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Growth hormone and factor-related products

Related Products Documents