Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Exodus-2 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CCL21, 6Ckine, SLC, CCL21
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10128005 5 µg
RBG10128020 20 µg
RBG10128100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Exodus-2 is a CC chemokine that signals through the CCR7 receptor. It is expressed in lymph nodes of certain endothelial cells, and in the spleen and appendix. Exodus-2 chemoattracts T and B lymphocytes and inhibits hematopoiesis. Exodus-2 contains six cysteine residues, including the four conserved cysteines present in CC chemokines. Recombinant Human Exodus-2 is a 12.2 kDa protein containing 111 amino acid residues.

Amino Acid Sequence

SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCRKTERSQTPKGP

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract total lymphocyte population using a concentration range of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation, Immunology

Related Products Documents