Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

FGF-17 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Fibroblast Growth Factor-17, FGFH
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10141005 5 µg
RBG10141025 25 µg
RBG10141100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

FGF-17 is a heparin binding growth factor that is a member of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-17 signals through the FGFR 1c, 2c, 3c, and 4. FGF-17 signals induction and patterning of embryonic brain. Recombinant Human FGF-17 is a 22.7 kDa protein consisting of 195 amino acid residues.

Amino Acid Sequence

MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Source

E. coli

Purity

95%

Biological Activity

Assay #1: The ED 50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF-receptors is 0.5 ng/ml, corresponding to a specific activity of 2×10 6 units/mg.  Assay #2: The ED 50 was determined by a cell proliferation assay using balb/c 3T3 cells is 10.0 ng/ml, corresponding to a specific activity of 1×10 5 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease

Related Products Documents