Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

FGF-20 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Fibroblast Growth Factor-20, FGFK
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10144003 3 µg
RBG10144015 15 µg
RBG10144100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

FGF-20 is a secreted heparin binding growth factor that is a member of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-20 signals through the FGFR 2c and 3c, and is expressed during limb and brain development. Recombinant Human FGF-20 is a 23.2 kDa protein containing 209 amino acid residues.

Amino Acid Sequence

PLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT

Source

E. coli

Purity

90%

Biological Activity

The ED 50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF-receptors is 10 ng/ml, corresponding to a specific activity of 1×10 5 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease, Oncology

Related Products Docs