Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

FGF-5 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Fibroblast Growth Factor-5, HBGF-5, Smag-82
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10135010 10 µg
RBG10135050 50 µg
RBG10135100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

FGF-5 is a secreted heparin binding growth factor that belongs to the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-5 binds to FGFR 1c and 2c, and plays a regulatory role in the hair growth cycle. Recombinant Human FGF-5 is a 27.6 kDa protein consisting of 252 amino acid residues.

Amino Acid Sequence

MAWAHGEKRLAPKGQPGPAATDRNPIGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKNPPSPIKSKIPLSAPRKNTNSVKYRLKFRFG

Source

E. coli

Purity

95%

Biological Activity

The ED 50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF-receptors is 0.5 ng/ml, corresponding to a specific activity of 2×10 a units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.5–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease

Related Products Docs