Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

FGF-acidic Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Fibroblast Growth Factor-acidic, FGF-1, HBGF-1, ECGF-beta
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10132010 10 µg
RBG10132050 50 µg
RBG10132100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

FGF-acidic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-acidic is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. FGF-acidic has the ability to signal through all the FGF receptors. Recombinant Human FGF-acidic is a 16.8 kDa protein consisting of 141 amino acid residues.

Amino Acid Sequence

MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Source

E. coli

Purity

95%

Biological Activity

Assay #1: The ED 50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors is ≤ 10 ng/ml, corresponding to a specific activity of ≥ 1×10 5 units/mg. Assay #2: The ED 50 was determined by a cell proliferation assay using balb/c 3T3 cells is ≤ 0.5 ng/ml in the presence of 10 μg/ml heparin, corresponding to a specific activity of ≥ 2×10 6 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in 5mM Sodium Phosphate, pH 8.0 to a concentration of <0.5 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease, Neural tissue markers, Oncology

Related Products Documents