Type
Recombinant protein
Description
FGF-acidic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-acidic is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. FGF-acidic has the ability to signal through all the FGF receptors. Recombinant Murine FGF-acidic is a 15.9 kDa protein consisting of 141 amino acid residues.
Amino Acid Sequence
MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Source
E. coli
Purity
95%
Biological Activity
Assay #1: The ED50 as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells in the presence of heparin is ≤ 0.5 ng/ml corresponding to a specific activity of ≥ 2×106 units/mg. Assay #2: The ED50 was determined by a cell proliferation assay using balb/c 3T3 cells is ≤ 0.2 ng/ml in the presence of 10 μg/ml heparin, corresponding to a specific activity of ≥ 5×106 units/mg.
Endotoxin
Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in 5mM Sodium Phosphate, pH 7.0–7.2 to a concentration of 0.5–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C
Storage/Expiration
–20°C