Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

FGF-basic Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Fibroblast Growth Factor-basic, FGF-2, HBGF-2, Prostatropin, FGF basic, FGF-basic
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20068010 10 µg
RBG20068050 50 µg
RBG20068100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

FGF-basic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland, liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4. Recombinant Murine FGF-basic is a 16.3 kDa protein consisting of 145 amino acid residues.

Amino Acid Sequence

PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Source

E. coli

Purity

95%

Biological Activity

Assay #1: The ED50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors is ≤ 0.1 ng/ml corresponding to a specific activity of ≥ 1×107 units/mg. Assay #2: The ED50 was determined by a cell proliferation assay using balb/c 3T3 cells is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1×106 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease, Neural tissue markers, Oncology, Animal studies

Related Products Documents