Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

Fibroblast Growth Factor 15 Mouse E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:FGF-15
  • Species:Mouse
Please select your region to see available products and prices.
Cat. No. Size Price


RD272184025 0.025 mg
RD272184100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 203 AA. MW: 23.78 kDa (calculated). UniProtKB acc.no. O35622. N-Terminal His-tag, 10 extra AA (highlighted).

Amino Acid Sequence

MKHHHHHHASRPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK

Source

E. coli

Purity

Purity as determined by densitometric image analysis: >90%

SDS-PAGE Gel

12% SDS-PAGE separation of Mouse FGF15
1. M.W. marker – 97, 66, 45, 31, 21, 14 kDa
2. reduced and boiled sample, 2.5μg/lane
3. non-reduced and non-boiled sample, 2.5μg/lane

Endotoxin

< 0.1 EU/μg

Formulation

Filtered (0.4 μm) and frozen from 0.2 – 0.5 mg/mL solution in 20mM TRIS, 50mM NaCl, pH = 8.5

Reconstitution

Defrost at ambient temperature

Applications

Western blotting

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store protein at –80°C. Protein remains stable until the expiry date when stored at –80°C. Avoid repeated freezing/thawing cycles. The thawed protein can be stored at 4 °C for three days.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Energy metabolism and body weight regulation, Animal studies

Related Products Docs