Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

G-CSF Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Granulocyte Colony-Stimulating Factor, CSF-3, MGI-1G, GM-CSF beta, pluripoietin
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10158002 2 µg
RBG10158010 10 µg
RBG10158100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

G-CSF is a hematopoietic growth factor that stimulates the development of committed progenitor cells to neutrophils and enhances the functional activities of the mature end-cell. It is produced in response to specific stimulation by a variety of cells including macrophages, fibroblasts, endothelial cells and bone marrow stroma. G-CSF is being used clinically to facilitate hematopoietic recovery after bone marrow transplantati­on. Human and murine G-CSF are cross-species reactive. Recombinant human G-CSF is an 18.7 kDa protein consisting of 174 amino acid residues.

Amino Acid Sequence

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Source

E. coli

Purity

98%

Biological Activity

The ED50 as determined by the dose-dependent stimulation of the proliferation of murine NFS-60 cells is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1×107 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease, Diabetology - Other Relevant Products, Oncology

Related Products Documents