Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

gAcrp30/Adipolean Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:apm-1, Adipolean (human)
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10152005 5 µg
RBG10152025 25 µg
RBG10152100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

gAcrp30 is a naturally occurring globular protein obtained by proteolytic processing of adiponectin. Adiponectin is produced and secreted exclusively by adipocytes, and is a relatively abundant plasma protein, accounting for up to 0.05% of total serum protein. Like Adiponectin, gAcrp30 is capable of decreasing hyperglycemia and reversing insulin resistance. Additionally, gAcrp30 has been shown to be an important factor in promoting fat loss by signaling muscle to absorb and burn Free-Fatty Acids (FFAs). The signaling receptors for adiponectin and gAcrp30 have recently been identified and named AdipoR1 and AdipoR2. AdipoR2 is predominantly expressed in the liver. Recombinant Human gAcrp30/Adipolean is a 16.6 kDa protein consisting of 145 amino acid residues.

Amino Acid Sequence

MKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to inhibit the proliferation of murine M1 cells. The expected ED 50 for this effect is 1.0–3.0 µg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.5–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Energy metabolism and body weight regulation

Related Products Documents