Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Galectin-3 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Galactose specific lectin 3, Mac-2 antigen, 35 kDa lectin, Carbohydrate binding protein 35, Laminin binding protein
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10155010 10 µg
RBG10155050 50 µg
RBG10155100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Lectins, of either plant or animal origin, are carbohydrate-binding proteins that interact with glycoproteins and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-3 regulates a number of biological processes, including embryogenesis, inflammatory responses, cell progression and metastasis. Galectin-3 is normally expressed in epithelia of a variety of tissues, including colon and endometrium, and in various inflammatory cells, including macrophages. Galectin-3 can function intracellularly, controlling the cell cycle and preventing T-cell apoptosis, and also extracellularly, by activating various cells, including monocytes/macrop­hages, mast cells, neutrophils, and lymphocytes. Expression of Galectin-3 is affected by neoplastic transformation, being up-regulated in certain types of lymphomas, and in thyroid and hepatic carcinomas. Conversely, it is down-regulated in other cancers such as colon, breast, ovarian, and uterine. Recombinant Human Galectin-3 is a globular 26.0 kDa protein containing 250 amino acid residues, but no disulfide bonds.

Amino Acid Sequence

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human blood monocytes. Chemotactic activity was observed at a concentration of 2.5µg/ml with a peak response obtained at 250µg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Immune Response, Infection and Inflammation

Summary

Galectin-3 is a 26kDa B-galactoside-binding protein belonging to the Galectin family, which consists of more than ten members. Galectin-3 is composed of a carboxyl-terminal carbohydrate recognition domain (CRD) and amino-terminal tandem repeats. Galectin-3 normally distributes in epithelia of many organs and various inflammatory cells, including macrophages as well as dendritic cells and Kupfer cells. The expression of this lectin is up-regulated during inflammation, cell proliferation and cell differentiation and through transactivation by viral proteins. Its expression is also affected by neoplastic transformation: upregulation is found in certain types of lymphomas, and thyroid carcinoma, while it is down regulated in other types of malignancies such as colon, breast, ovarian and uterine carcinomas. The expression of Galectin-3 has a strong correlation with the grade and malignant potential of primary brain tumors. Increased Galectin-3 levels have also been noted in human atherosclerotic lesions. These findings suggest that Galectin-3 expression is affected during these physiological and pathological responses. Galectin-3 has been shown to function through both intracellular and extracellular actions. It is a component of heterogeneous nuclear ribonuclear protein (hnRNP), a factor in pre-mRNA splicing and has been found to control cell cycle and prevent T-cell apoptosis through interaction with the Bcl-2 family members. On the other hand, this protein, which is secreted from monocytes/macrop­hages and epithelial cells has been demonstrated to function as an extracellular molecule in activating various types of cells such as monocytes/macrop­hages, mast cells, neutrophils and lymphocytes. Galectin-3 has been shown to mediate cell-cell and cell-extracellular matrix interactions and acts as a novel chemoattractant for monocytes and macrophages.

Related Products Documents