Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Ganglioside GM2 Activator Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Cerebroside sulfate activator protein, GM2-AP, Shingolipid activator protein 3, SAP-3, GM2AP
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172309100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 170 AA. MW: 18.7 kDa (calculated). UniProtKB acc.no. P17900 (Ser33-Ile193). N-terminal His-tag (9 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 95 %

SDS-PAGE Gel

14% SDS-PAGE separation of Hu GM2AP:
1. M.W. marker – 97, 66, 45, 31, 21, 14 kDa
2. reduced and heated sample, 2.5μg/lane
3. non-reduced and non-heated sample, 2.5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 0.05 M tris buffer, 0.1 M NaCl, pH 8.0

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Energy metabolism and body weight regulation, Metabolic syndrome, Neural tissue markers

Summary

Ganglioside GM2 activator protein (GM2AP) is product of the GM2A gene and consists of 170 amino acids. It is a small (20 kDa), heat stable, long-lived, protease-resistant glycosylated protein that normally resides in the lysozome. GM2AP is an essential cofactor to β-hexosaminidase A (Hex A) in the degradation of GM2 ganglioside to GM3 form. The protein mediates the interaction between the water-soluble exohydrolase and its membrane-embedded glycolipid substrate at the lipid–water interface. It also acts as a lipid transfer protein. Because of the presence of an N-terminal signal peptide, N-linked glycosylation, and disulfide bonds, it is clear that the activator is synthesized in the endoplasmic reticulum. The protein is first synthesized as a precursor which is then glycosylated, modified, and cleaved at 32Ser to the mature form. GM2AP contains at least three functional elements: a hydrophobic β-cup structure forming a spacious hydrophobic cavity, an oligosaccharide binding site, and an area that interacts with alpha subunit of HexA. Butkus and Coghlan revealed by northern analysis that GM2AP mRNA has a widespread distribution in ovine tissue. In the kidney, GM2 was expressed in all major renal arteries and arterioles. In the liver, the expression of the gene was prominent in the hepatic vein and duct. Antibodies raised against the GM2AP confirmed that the protein is present at the same sites as the mRNA. A deficiency of the GM2AP due to a mutation in respective gene can lead to the accumulation of GM2 in the lysosomes of primarily neuronal cells, where the synthesis of the more complex gangliosides is the greatest. This storage leads to neuronal cell death and one of three similar neurodegenerative diseases collectively known as GM2 gangliosidosis. On the other hand, up-regulation of GM2AP expression by oxidized LDL enhances ganglioside accumulation in the aorta, which may be strongly associated with atherosclerosis. Highashi et al observed that administration of GM2AP to mice significantly increased serum insulin levels and blockage of GM2AP function by specific antibodies inhibited insulin secretion. They also observed higher concentration of GM2AP in human serum of obese subjects by ELISA. Areas of investigation: - Diabetology - Metabolic syndrome - CNS disorders

References to Summary

References to Ganglioside GM2 Activator

  • Butkus A, Coghlan JP. Location of ganglioside GM2 activator protein gene expression in sheep. Clin Exp Pharmacol Physiol Sup. 1998 Nov;25:S28-33
  • Higashi K, Kubo H, Watanabe H, Fujimori K, Mikami T, Kaneko H. Adipokine ganglioside GM2 activator protein stimulates insulin secretion. FEBS Lett. 2011 Aug 19;585 (16):2587-91
  • Higashi K, Mikami T, Yamada T, Kawashima H, Kimura T, Kaneko H. A novel adipokine GM2AP impairs insulin signaling. Biochem Biophys Res Commun. 2010 Nov 19;402 (3):571-6
  • Kolter T, Sandhoff K. Principles of lysosomal membrane digestion: stimulation of sphingolipid degradation by sphingolipid activator proteins and anionic lysosomal lipids. Annu Rev Cell Dev Biol. 2005;21:81-103
  • Mathias JD, Ran Y, Carter JD, Fanucci GE. Interactions of the GM2 activator protein with phosphatidylcholine bilayers: a site-directed spin-labeling power saturation study. Biophys J. 2009 Sep 2;97 (5):1436-44
  • Ran Y, Fanucci GE. Ligand extraction properties of the GM2 activator protein and its interactions with lipid vesicles. Biophys J. 2009 Jul 8;97 (1):257-66
  • Rigat B, Yeger H, Shehnaz D, Mahuran D. GM2 activator protein inhibits platelet activating factor signaling in rats. Biochem Biophys Res Commun. 2009 Aug 7;385 (4):576-80
  • Sinici I, Yonekawa S, Tkachyova I, Gray SJ, Samulski RJ, Wakarchuk W, Mark BL, Mahuran DJ. In cellulo examination of a beta-alpha hybrid construct of beta-hexosaminidase A subunits, reported to interact with the GM2 activator protein and hydrolyze GM2 ganglioside. PLoS One. 2013;8 (3):e57908
  • Wendeler M, Werth N, Maier T, Schwarzmann G, Kolter T, Schoeniger M, Hoffmann D, Lemm T, Saenger W, Sandhoff K. The enzyme-binding region of human GM2-activator protein. FEBS J. 2006 Mar;273 (5):982-91
  • Wright CS, Li SC, Rastinejad F. Crystal structure of human GM2-activator protein with a novel beta-cup topology. J Mol Biol. 2000 Dec 1;304 (3):411-22
  • Yanai H, Yoshida H, Tomono Y, Tada N, Chiba H. The possible contribution of a general glycosphingolipid transporter, GM2 activator protein, to atherosclerosis. J Atheroscler Thromb. 2006 Dec;13 (6):281-5
Related Products Documents