Gastrotropin Human E. coli

Cat. No.	Size	Price
RD172248100	0.1 mg

Technical Data

Type

Recombinant protein

Description

Total 137 AA. MW: 15.5 kDa (calculated). UniProtKB acc.no. P51161. N-Terminal His-tag (10 extra AA)

Amino Acid Sequence

MKHHHHHHASAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

14% SDS-PAGE separation of Human Gastrotropin
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 2.5μg/lane
3. non-reduced and non-heated sample, 2.5μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0,4 μm) and lyophilized in 0.5 mg/mL in 20 mM Tris buffer, 50 mM NaCl, pH 7.5.

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store lyophilized protein at -80°C. Lyophilized protein remains stable until the expiry date when stored at -80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein. LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Oncology, Others, Reproduction

Summary

FABP6 is protein from family fatty acid-binding proteins (FABPs). FABP6 is highly expressed in the enterocytes of ileum and to a lesser extent in the luteal cells of ovaries, placenta and adrenal glands. FABP6 acts as an intracellular transporter of bile acids in ileal epithelial cells, helping to metabolize cholesterol. FABP6 plays a significant role in granulosa cells differentiation required for follicular rupture.

FABP6 is potential biomarker for various cancers and it may be useful clinically in cancer diagnosis and for the assessment of cancer therapy. The expression of FABP6 was higher in primary colorectal cancers and adenomas than in normal epithelium, but was dramatically decreased in lymph node metastases. Tumors with high FABP6 expression were more frequently located in left colon than the right colon and had shallower invasion into the bowel wall. Tumors with high expression FABP6 were smaller in size. Increase FABP6 expression were described for prostate, bladder and renal cell carcinoma.

Summary References (8)

References to Gastrotropin (FABP6)

Collado-Romero M, Aguilar C, Arce C, Lucena C, Codrea MC, Morera L, Bendixen E, Moreno A, Garrido JJ: Quantitative proteomics and bioinformatics analysis provide new insight into dynamic response of porcine intestine to Salmonella Typhimurium. J of Frontiers in Cellular and Infection Microbiology. September; 5 (64): (2015)
Duggavathi R, Siddappa D, Schuermann Y, Pansera M, Menard IJ, Praslickova D, Agellon LB: The fatty acid binding protein 6 gene (Fabp6) is expressed in murine granulosa cells and is involved in ovulatory response to superstimulation. J of Reproduction and Development. March; 61 (3): 237 – 240 (2015)
Ohmachi T, Inoue H, Mimori K, Tanaka F, Sasaki A, Kanda T, Fujii H, Yanaga K, Mori M: Fatty Acid Binding Protein 6 Is Overexpressed in Colorectal Cancer. J of Clinical Cancer Research. September; 12 (17): 5090 – 5095 (2006)
Ono T, Odani S: Initial studies of the cytoplasmic FABP superfamily. J of Proceedings of the Japan Academy Series B. 86 (3): 220 – 228 (2010)
Praslickova D, Torchia EC, Sugiyama MG, Magrane EJ, Zwicker BL, Kolodzieyski L, Agellon LB: The Ileal Lipid Binding Protein Is Required for Efficient Absorption and Transport of Bile Acids in the Distal Portion of the Murine Small Intestine. J of PLOS ONE. December; 7 (22): e50810 (2012)
Smathers RL, Petersen DR: The human fatty acid-binding protein family: Evolutionary divergenes and functions. J of Human Genomics. March; 5 (3): 170 – 191 (2011)
Tölle A, Suhail S, Jung M, Jung K, Stephan C: Fatty acid binding proteins (FABPs) in prostate, bladder and kidney cancer cell lines and the use of IL-FABP as survival predictor in patients with renal cell carcinoma. J of BMC Cancer. July; 11 (302): (2011)
Uribe JH, Collado-Romero M, Zaldívar-López S, Arce C, Bautista R, Carvajal A, Cirera S, Claros MG, Garrido: Transcriptional analysis of porcine intestinal mucosa infected with Salmonella Typhimurium revealed a massive inflammatory response and disruption of bile acid absorption in ileum. J of Veterinary Research. January; 47 (11): (2016)

Docs

Product Datasheet (RUO)

Datasheet PDF (RUO)

Safety Information (RUO)

MSDS (RUO)