Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

GCP-2 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CXCL6, LIX (murine)
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10157005 5 µg
RBG10157020 20 µg
RBG10157100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

CXCL6, also known as GCP-2 in humans, is a connective tissue-derived CXC chemokine that can signal through the CXCR1 and CXCR2 receptors. Human GCP-2, which is cross-reactive with murine cells, selectively attracts neutrophils, and has also been shown to exert anti-angiogenic activity. Recombinant Human GCP-2 is a 7.9 kDa protein containing 72 amino acid residues.

Amino Acid Sequence

VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human neutrophils using a concentration range of 10.0–50.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Bone and cartilage metabolism, Cardiovascular disease, Chemokines, Coronary artery disease, Cytokines and chemokines and related molecules

Related Products Documents