Type
Recombinant protein
Description
GDF-15 belongs to the TGF-β cytokine family, whose members play an important role during prenatal development and postnatal growth, and the remodeling and maintenance of a variety of tissues and organs. GDF-15 is expressed predominantly in the placenta and, to a much lesser extent, in various other tissues. The presence of GDF-15 in amniotic fluid and its elevated levels in the sera of pregnant women suggest GDF-15's involvement in gestation and embryonic development. GDF-15 generally exerts tumor suppressive activities and is one of the predominant factors produced and secreted in response to activation of the p53 pathway. Interestingly, the serum level of GDF-15 is positively correlated with neoplastic progression of several tumor types, including certain colorectal, pancreatic, and prostate cancers. Human GDF-15/MIC-1 is a disulfide linked homodimeric protein consisting of two 112 amino acid polypeptide chains. The calculated molecular weight of Human GDF-15/MIC-1 is 24.6 kDa.
Amino Acid Sequence
ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Source
Chinese Hamster Ovary Cells (CHO)
Purity
≥ 95% by SDS-PAGE gel and HPLC analyses.
Biological Activity
Determined by its ability to inhibit alkaline phosphatase activity in differentiating MC3T3/E1 osteoblastcells. The expected ED50 for this effect is 75-200 ng/ml.
Storage/Expiration
–20°C