Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

GDF-2 Human Chinese Hamster Ovary Cells (CHO)

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:Chinese Hamster Ovary Cells (CHO)
  • Other names:Growth/Differentiation Factor-2, BMP-9
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10159002 2 µg
RBG10159010 10 µg
RBG10159100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

GDF-2 belongs to the TGF-β cytokine family, whose members play an important role during prenatal development and postnatal growth, and the remodeling and maintenance of a variety of tissues and organs. GDF-2 is expressed mainly in non-parenchymal cells of the liver, but is also found in other various cells and tissues. GDF-2 can signal through the ALK1 receptor, and has been implicated in a number of physiologic events including the regulation of the hepatic reticuloendothelial system, glucose homeostasis, iron homeostasis, and the inhibition of angiogenesis. Recombinant Human GDF-2 is a 24.1 kDa disulfide-linked homodimeric protein consisting of two 110 amino acid polypeptide chains.

Amino Acid Sequence

SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Source

Chinese Hamster Ovary Cells (CHO)

Purity

95%

Biological Activity

Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED 50 for this effect is 0.5–1.9 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease

Related Products Docs