Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

GDF-3 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Growth/Differentiation Factor-3
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10160005 5 µg
RBG10160020 20 µg
RBG10160100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

GDF-3 is a member of the TGF-β superfamily of growth and differentiation factors, and is highly homologous to GDF-9. Unlike most TGF-β family members, GDF-3 and GDF-9 are not disulfide-linked dimers. GDF-3 is expressed in adult bone marrow, spleen, thymus, and adipose tissue. The expression of GDF-3 is upregulated in high-fat-fed wild-type FABP4/aP2 null mice and was associated with obesity, but not with the related hyperglycemia/hy­perinsulinemia that characterizes Type 2 diabetes. Recombinant Human GDF-3 is a 26.0 kDa non-disulfide-linked homodimer containing two 114 amino acid polypeptide chains.

Amino Acid Sequence

AAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to inhibit induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The ED 50 for this effect is 100–150 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Diabetology - Other Relevant Products

Related Products Documents