Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

GDF-5 (BMP-14/CDMP-1) Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:BMP-14/CDMP-1, BMP-14, Cartilage-Derived Morphogenetic Protein-1 (CDMP-1)
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20073010 10 µg
RBG20073050 50 µg
RBG20073100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

GDF-5 is expressed in long bones during embryonic development and postnatally in articular cartilage. Mutations in the GDF-5 gene have been implicated in Hunter-Thompson type dwarfism and in Grebe Syndrome, which is characterized by short stature, extra digits, and short and deformed extremities. The mature and functional form of GDF-5 is a homodimer of two 120 amino acid polypeptide chains (monomers) linked by a single disulfide bond. Each GDF-5 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 27 amino acid signal peptide and a 348 amino acid propeptide. This precursor undergoes intracellular dimerization, and upon secretion it is processed by a furin-type protease. Recombinant Murine GDF-5 is a 27.0 kDa homodimeric disulfide-linked protein consisting of two 120 amino acid polypeptide chains.

Amino Acid Sequence

APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 1.0–2.0 µg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Others, Animal studies

Related Products Documents