Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

GDF-7 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Growth/Differentiation Factor-7, BMP-12
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10162002 2 µg
RBG10162010 10 µg
RBG10162100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

GDF-7 belongs to the TGF-β superfamily of growth and differentiation factors. It is expressed selectively by roof plate cells that are located in the developing embryonic central nervous system, and has been shown to influence the neuronal identity of cells within the central nervous system. GDF-7 has also been implicated in the formation, maintenance, and repair of certain cartilage and ligament tissues. Recombinant Human GDF-7 is a 28.0 kDa disulfide-linked homodimer containing two 129 amino acid residues.

Amino Acid Sequence

TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to inhibit induced alkaline phosphatase production by ATDC-5 chondrogenic ce­lls.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Bone and cartilage metabolism

Related Products Documents