Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

GM-CSF Rat E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Granulocyte-macrophage colony stimulating factor, Molgramostin, Sargramostim, Colony-stimulating factor
  • Species:Rat
Please select your region to see available products and prices.
Cat. No. Size Price


RBG30058005 5 µg
RBG30058020 20 µg
RBG30058100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

GM-CSF is a hematopoietic growth factor that stimulates the development of neutrophils and macrophages, and promotes the proliferation and development of early erythroid megakaryocytic and eosinophilic progenitor cells. It is produced in by endothelial cells, monocytes, fibroblasts and T-lymphocytes. GM-CSF inhibits neutrophil migration and enhances the functional activity of the mature end-cells. The human and murine molecules are species-specific and exhibit no cross-species reactivity. Recombinant Rat GM-CSF is a 14.5 kDa globular protein consisting of 128 amino acid residues.

Amino Acid Sequence

MAPTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

Source

E. coli

Purity

98%

Biological Activity

The ED50 was determined by the dose-dependent stimulation of the proliferation of Murine FDC-P1 cells is ≤ 0.01 ng/ml, corresponding to a specific activity of ≥ 1.0×108 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules, Animal studies

Summary

GM-CSF is a small glycoprotein growth factor which stimulates the production and function of neutrophils, eosinophils and monocytes. It can be produced by a wide variety of tissue types. The biological effects of GM-CSF are mediated through its binding to cell surface receptors, which appear to be widely expressed by thermatopoietic cells and also by some non-thermatopoietic cells, such as endothelial cells.

Related Products Documents