Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

GMF-β Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Glia Maturation Factor beta, GMFB
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10168002 2 µg
RBG10168010 10 µg
RBG10168100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

GMF-β is a brain-specific protein that belongs to the actin-binding proteins ADF structural family. GMF-β appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-inflammatory cytokines. Recombinant Human GMF-β is a 16.5 kDa globular protein containing 141 amino acid residues, including one intramolecular disulfide bond.

Amino Acid Sequence

SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH

Source

E. coli

Purity

98%

Biological Activity

Data Not Available.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C

Summary

Research topic

Neural tissue markers

Related Products Documents