Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

GRO-β Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Growth Regulated Protein/Melanoma Growth Stimulatory Activity (MGSA ß), CXCL2, MIP-2, GRO2
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10171002 2 µg
RBG10171010 10 µg
RBG10171100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. The GRO proteins chemoattract and activate neutrophils and basophils. Recombinant Human GRO-β is a 7.9 kDa protein consisting of 73 amino acids, including the ‘ELR’ motif common to the CXC chemokine family that binds to CXCR1 or CXCR2.

Amino Acid Sequence

APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract CXCR2 transfected 293 cells using a concentration range of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Chemokines, Coronary artery disease, Cytokines and chemokines and related molecules, Neural tissue markers

Related Products Documents