HAPLN1 Human, E.coli Recombinant

Cat. No.	Size	Price
New RP1722012010	10 μg
New RP17220121MG	1 mg

Technical Data

Type

Recombinant protein

Description

HAPLN1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 362 amino acids (16-354 a.a.) and having a molecular mass of 40.9kDa. HAPLN1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

Amino Acid Sequence

MGSSHHHHHHSSGLVPRGSHMGSDHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN.

Source

E. coli

Purity

Greater than 80.0%

Formulation

HAPLN1 protein solution (1mg/ml) containing 20mM Tris-HCl buffer (pH 8.0), 0.4M Urea and 10% glycerol.

Applications

Cell culture and/or animal studies, In vitro

Shipping

On frozen gel ice packs. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.

Note

This BioVendor product is furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Summary

Research topic

Bone and cartilage metabolism, Extracellular matrix, Oncology

Summary

Hyaluronan And Proteoglycan Link Protein 1 (HAPLN1) is is a 354-amino acid glycoprotein belonging to a link protein gene family that consists of four HAPLN members. All four link proteins show similar structure, with NH2-terminal signal sequence followed by immunoglobulin-like domain and two link modules or proteoglycan tandem repeats

As an important component of cartilage extracellular matrix (ECM), HAPLN1 stabilizes the aggregates of proteoglycan monomers by means of hyaluronic acid (HA). In the absence of HAPLN1, aggregates are smaller and less stable. HAPLN1 binds aggrecan along the HA chain with a 1:1 stoichiometry. The resulting aggregates are entrapped within the mesh-like network of type II collagen fibrils producing a large stable macromolecular structure that contributes to compression resistance and shock absorption in the joint.

HAPLN1 is also highly expressed in noncartilaginous tissues such as small intestine and placenta, embryonic and adult heart tissues, and, to a lower extent, many other tissues.

Analysis of HAPLN1 expression levels in malignant pleural mesothelioma (MPM) patients showed that high level of HAPLN1 is associated with fast progression and poorer survival, thus suggesting potential of HAPLN1 as an MPM prognostic marker.

Docs

Product Datasheet (RUO)

Datasheet PDF (RUO)

Safety Information (RUO)

MSDS (RUO)