Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

HB-EGF Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Heparin Binding EGF-like growth factor, HBEGF, Diphtheria toxin receptor, DTR
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10173010 10 µg
RBG10173050 50 µg
RBG10173100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

HB-EGF is an EGF-related growth factor that signals through the EGF receptor, and stimulates the proliferation of smooth muscle cells (SMC), fibroblasts, epithelial cells, and keratinocytes. HB-EGF is expressed in numerous cell types and tissues, including vascular endothelial cells, and vascular SMC, macrophages, skeletal muscle, keratinocytes, and certain tumor cells. The ability of HB-EGF to specifically bind heparin and heparin sulfate proteoglycans is distinct from other EGF-like molecules, and may be related to the enhanced mitogenic activity, relative to EGF, that HB-EGF exerts on smooth muscle cells. The human HB-EGF gene encodes a 208 amino acid transmembrane protein, which can be proteolytically cleaved to produce soluble HB-EGF. Recombinant Human HB-EGF is a 9.7 kDa protein containing 86 amino acid residues, corresponding to the extracellular EGF-like and heparin-binding domains of the full length HB-EGF protein.

Amino Acid Sequence

DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Source

E. coli

Purity

95%

Biological Activity

The ED 50 was determined by a cell proliferation assay using balb/c 3T3 cells is 1.0 ng/ml, corresponding to a specific activity of 1×10 6 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Cardiovascular disease, Coronary artery disease

Related Products Docs