Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

HCC-1 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CCL14
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10174002 2 µg
RBG10174010 10 µg
RBG10174100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

HCC-1 is a CC chemokine that signals through the CCR1 receptor and chemoattracts blood monocytes. It is secreted by various tissues, including skeletal muscle, heart, spleen, liver and bone marrow. Mature HCC-1 is found in four different forms, which are distinguished by differential N-terminal trucation and contain 74, 72, 71, or 66 amino acid residues. Recombinant Human HCC-1 is an 8.4 kDa protein consisting of 72 amino acids, including the four highly conserved residues present in CC chemokines.

Amino Acid Sequence

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human monocytes using a concentration range of 5.0–20.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Related Products Docs