Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

Heart Fatty Acid Binding Protein Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:FABP3, Fatty acid-binding protein 3, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-binding protein, M-FABP, FABP11
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172247100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 142 AA. MW: 15.97 kDa (calculated). UniProtKB acc.no. P05413. N-Terminal His-tag, 10 extra AA.

Amino Acid Sequence

MKHHHHHHASVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

14% SDS-PAGE separation of Human FABP3
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 5μg/lane
3. non-reduced and non-boiled sample, 5μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/mL solution in 20 mM Tris buffer, 50 mM NaCl, pH 7.5

Reconstitution

Add deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at -80 °C. Lyophilized protein remains stable until the expiry date when stored at -80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein. LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Cardiovascular disease, Energy metabolism and body weight regulation, Renal disease

Summary References (12)

References to Heart Fatty Acid Binding Protein

  • Pelsers MMAL, Hanhoff T, Van der Voort D, Arts B, Peters M, Ponds R, Honig A, Rudzinski W, Spener F, de Kruijk JR, Twijnstra A, Hermens W, Menheere PPCA, Glatz JFC: Brain and heart type fatty acid-binding proteins in the brain: Tissue distribution and clinical utility. Clin Chem 2004, 50(9):1568-1575
  • Cavus U, Coskum F, Yavuz B, Ciftci O, Sahiner L, Aksoy H, Deniz A, Ozakin E, Aytemir K, Tokgozoglu L, Kabakci G: Heart-type, fatty-acid binding protein can be a diagnostic marker in acute coronary syndrome. J Nat Med Ass 2006, 98(7):1067-1070
  • Storch J, McDermott L: Structural and functional analysis of fatty acid-binding proteins. J Lipid Res 2009, S126-S131
  • Hussain T, Shu LY, Sosorburam T: Importance of cardiac FABP as diagnostic marker of ischaemic heart injury in conjuction with chronic liver disease: A cohort study. Australian Medical J 2010, 3(11):691-694
  • Li Ch, Li J, Liang X, Li X, Cui J, Yang Z, Guo Q, Cao K, Huang J: Point-of-care test of heart-type fatty acid-binding protein for the diagnosis of early acute myocardial infarction. Acta Pharmacologica Sinica 2010, 31:307-312
  • Gururajan P, Gurumurthy P, Nayar P, Rao GSN, Babu S, Cherian KM: Heart fatty acid binding protein (H-FABP) as a diagnostic biomarker in patients with acute coronary syndrome. Heart, Lung and Circulation 2010, 19:660-664
  • Karbek B, Ozbek M, Bozkurt NC, Ginis Z, Gungunes A, Unsal IO, Cakal E, Delibasi T: Heart-type fatty acid binding protein (H-FABP): relationship with arterial intima-media thickness and role as diagnostic marker for atherosclerosis in patients with impaired glucose metabolism. Cardiovasc Diabet 2011, 10:37
  • Elmadbouh I, Mahfouz, Bayomy N, Faried W, Ghanayem N: The value of human heart-type fatty acid binding protein in diagnosis of patients with acute chest pain. The Egypt Heart J 2012, 64:179-184
  • Erenler AK, Yardan T, Duran L, Baydin A: Usefulness of heart-type fatty acid binding protein in the emergency department. J Pak Med Assoc 2013, 63(9):1176-1181
  • Willemsen RTA, Buntinx F, Winkens B, Glatz JF, Dinant GJ, RAPIDA-study team): The value of signs, symptoms and plasma heart-type fatty acid-binding protein (H-FABP) in evaluating patients presenting with symptoms possibly matching acute coronary syndrome: background and methods of a diagnostic study in primary care. BMC Family Pract 2014, 15:203
  • Pyati AK, devaranavadagi BB, Sajjannar SL, Nikam SV, Shannaway M, Sudharani: Heart-type fatty acid binding protein: a better cardiac biomarker than CK-MB and myoglobin in the early diagnosis of acute myocardial infarction. J Clin Diagn Research 2015, 9(10):BC08-BC11
  • Hoffmann U, Espeter F, Weis C, Ahmad-Nejad P, Lang S, Brueckmann M, Akin I, Neumaier M, Borggrefe M, Behnes M: Ischemic heart-type fatty acid binding protein (hFABP) in acute
Related Products Docs