Herstatin Human E. coli Tag free

Cat. No.	Size	Price
RD172039025	0.025 mg
RD172039100	0.1 mg

Technical Data

Type

Recombinant protein

Description

Total 398 AA. MW: 43.4 kDa (calculated). UniProtKB acc.no. Q9UK79. 397 AA of recombinant Human Herstatin and one extra AA, N-terminal methionin (highlighted).

Amino Acid Sequence

MTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARGTHSLPPRPAAVPVPLRMQPGPAHPVLSFLRPSWDLVSAFYSLPLAPLSPTSVPISPVSVGRGPDPDAHVAVDLSRYEG

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 95%

SDS-PAGE Gel

12% SDS-PAGE separation of Human Herstatin
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 2.5μg/lane
3. non-reduced and non-heated sample, 2.5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and frozen from 0.3 – 0.7 mg/mL solution in 0.05 M Acetate buffer pH=4.0 containing 5% of trehalose.

Reconstitution

Defrost at ambient temperature

Applications

Western blotting, ELISA

Shipping

On ice. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store protein at –80°C. Protein remains stable until the expiry date when stored at –80°C. Avoid repeated freezing/thawing cycles. The thawed protein can be stored at 4 °C for three days.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Oncology

Summary

HER-2/neu (erbB-2) encodes an 185-kDa orphan receptor tyrosine kinase that is constitutively active as a dimer and displays potent oncogenic activity when overexpressed. Herstatin, as the product of an alternative HER-2 transcript, retains intron 8. The herstatin mRNA is expressed in normal human fetal kidney and liver, but is at reduced levels relative to p185HER-2 mRNA in carcinoma cells that contain an amplified HER-2 gene. Herstatin appears to be an inhibitor of p185HER-2, because it disrupts dimers, reduces tyrosine phosphorylation of p185, and inhibits the anchorage-independent growth of transformed cells that overexpress HER-2.

Summary References (19)

References to Herstatin

Evidence by in situ hybridization that c-erbB-2 proto-oncogene expression is a marker of malignancy and is expressed in lung adenocarcinomas. Am J Respir Cell Mol Biol. 1992 Sep;7 (3):325-34
. Expression of the ERBB2 protein in benign and malignant salivary gland tumors. Genes Chromosomes Cancer. 1991 Mar;3 (2):128-35
al-Kasspooles M, Moore JH, Orringer MB, Beer DG. Amplification and over-expression of the EGFR and erbB-2 genes in human esophageal adenocarcinomas. Int J Cancer. 1993 May 8;54 (2):213-9
Berchuck A, Kamel A, Whitaker R, Kerns B, Olt G, Kinney R, Soper JT, Dodge R, Clarke-Pearson DL, Marks P, et al. Overexpression of HER-2/neu is associated with poor survival in advanced epithelial ovarian cancer. Cancer Res. 1990 Jul 1;50 (13):4087-91
Craven JM, Pavelic ZP, Stambrook PJ, Pavelic L, Gapany M, Kelley DJ, Gapany S, Gluckman JL. Expression of c-erbB-2 gene in human head and neck carcinoma. Anticancer Res. 1992 Nov-Dec;12 (6B):2273-6
Dittadi R, Donisi PM, Brazzale A, Marconato R, Spina M, Gion M. Immunoenzymatic assay of erbB2 protein in cancer and non-malignant breast tissue. Relationships with clinical and biochemical parameters. Anticancer Res. 1992 Nov-Dec;12 (6B):2005-10
Heatley M, Maxwell P, Whiteside C, Toner PG. C-erbB-2 oncogene product expression depends on tumour type and is related to oestrogen receptor and lymph node status in human breast carcinoma. Pathol Res Pract. 1993 Apr;189 (3):261-6
Kern JA, Schwartz DA, Nordberg JE, Weiner DB, Greene MI, Torney L, Robinson RA. p185neu expression in human lung adenocarcinomas predicts shortened survival. Cancer Res. 1990 Aug 15;50 (16):5184-7
Kynast B, Binder L, Marx D, Zoll B, Schmoll HJ, Oellerich M, Schauer A. Determination of a fragment of the c-erbB-2 translational product p185 in serum of breast cancer patients. J Cancer Res Clin Oncol. 1993;119 (5):249-52
Maguire HC Jr, Greene MI. The neu (c-erbB-2) oncogene. Semin Oncol. 1989 Apr;16 (2):148-55
Ohguri T, Sato Y, Koizumi W, Saigenji K, Kameya T. An immunohistochemical study of c-erbB-2 protein in gastric carcinomas and lymph-node metastases: is the c-erbB-2 protein really a prognostic indicator?. Int J Cancer. 1993 Jan 2;53 (1):75-9
Osaki A, Toi M, Yamada H, Kawami H, Kuroi K, Toge T. Prognostic significance of co-expression of c-erbB-2 oncoprotein and epidermal growth factor receptor in breast cancer patients. Am J Surg. 1992 Oct;164 (4):323-6
Paik S, Hazan R, Fisher ER, Sass RE, Fisher B, Redmond C, Schlessinger J, Lippman ME, King CR. Pathologic findings from the National Surgical Adjuvant Breast and Bowel Project: prognostic significance of erbB-2 protein overexpression in primary breast cancer. J Clin Oncol. 1990 Jan;8 (1):103-12
Paterson MC, Dietrich KD, Danyluk J, Paterson AH, Lees AW, Jamil N, Hanson J, Jenkins H, Krause BE, McBlain WA, et al. Correlation between c-erbB-2 amplification and risk of recurrent disease in node-negative breast cancer. Cancer Res. 1991 Jan 15;51 (2):556-67
Ross JS, Fletcher JA, Linette GP, Stec J, Clark E, Ayers M, Symmans WF, Pusztai L, Bloom KJ. The Her-2/neu gene and protein in breast cancer 2003: biomarker and target of therapy. Oncologist. 2003;8 (4):307-25
Rubin SC, Finstad CL, Wong GY, Almadrones L, Plante M, Lloyd KO. Prognostic significance of HER-2/neu expression in advanced epithelial ovarian cancer: a multivariate analysis. Am J Obstet Gynecol. 1993 Jan;168 (1 Pt 1):162-9
Sato K, Moriyama M, Mori S, Saito M, Watanuki T, Terada K, Okuhara E, Akiyama T, Toyoshima K, Yamamoto T, et al. An immunohistologic evaluation of C-erbB-2 gene product in patients with urinary bladder carcinoma. Cancer. 1992 Nov 15;70 (10):2493-8
Seidman JD, Frisman DM, Norris HJ. Expression of the HER-2/neu proto-oncogene in serous ovarian neoplasms. Cancer. 1992 Dec 15;70 (12):2857-60
Slamon DJ, Clark GM, Wong SG, Levin WJ, Ullrich A, McGuire WL. Human breast cancer: correlation of relapse and survival with amplification of the HER-2/n

Docs

Product Datasheet (RUO)

Datasheet PDF (RUO)

Safety Information (RUO)

MSDS (RUO)