Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

HVEM-Fc Human Hi-5 Insect cells

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:Hi-5 Insect cells
  • Other names:HVEM, TNFSFR14, ATAR, TR2
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10178020 20 µg
RBG10178100 100 μg
RBG10178200 200 µg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

HVEM belongs to the TNF Receptor superfamily of transmembrane proteins, and plays a role in the activation of T-cells and other lymphocytes. It is expressed in various cells and tissues, including spleen, thymus, lung, macrophages, and T-cells. HVEM activation induces a signaling cascade that results in the induction of transcription factors NF-κB and AP-1. LIGHT (TNFSF14) and TNF-β (TNFSF1) function as the ligands for HVEM, which can also bind specifically to herpes simplex virus glycoprotein D. Soluble HVEM can act as a “receptor decoy” resulting in inhibition of the activity of the HVEM ligands, LIGHT and TNF-β. Recombinant human HVEM-Fc Chimera is a 376 amino acid fusion protein that contains an N-terminal domain corresponding to the extracellular region of HVEM, and a C-terminal domain corresponding to residues 102 to 330 of human IgG1. The calculated molecular weight of Recombinant Human HVEM-Fc is 41.4 kDa.

Amino Acid Sequence

LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Source

Hi-5 Insect cells

Purity

98%

Biological Activity

Determined by its ability to neutralize 0.25 ng/ml of hTNFβ; induced cytotoxicity on murine L929 cells. The expected ED 50 for this effect is 1.3–1.9 µg/ml of HVEM-Fc.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis

Related Products Docs