Type
Recombinant protein
Description
HVEM belongs to the TNF Receptor superfamily of transmembrane proteins, and plays a role in the activation of T-cells and other lymphocytes. It is expressed in various cells and tissues, including spleen, thymus, lung, macrophages, and T-cells. HVEM activation induces a signaling cascade that results in the induction of transcription factors NF-κB and AP-1. LIGHT (TNFSF14) and TNF-β (TNFSF1) function as the ligands for HVEM, which can also bind specifically to herpes simplex virus glycoprotein D. Soluble HVEM can act as a “receptor decoy” resulting in inhibition of the activity of the HVEM ligands, LIGHT and TNF-β. Recombinant human HVEM-Fc Chimera is a 376 amino acid fusion protein that contains an N-terminal domain corresponding to the extracellular region of HVEM, and a C-terminal domain corresponding to residues 102 to 330 of human IgG1. The calculated molecular weight of Recombinant Human HVEM-Fc is 41.4 kDa.
Amino Acid Sequence
LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Source
Hi-5 Insect cells
Purity
98%
Biological Activity
Determined by its ability to neutralize 0.25 ng/ml of hTNFβ; induced cytotoxicity on murine L929 cells. The expected ED 50 for this effect is 1.3–1.9 µg/ml of HVEM-Fc.
Endotoxin
Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.
Storage/Expiration
–20°C