Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

I-309 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CCL1, TCA-3
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10179002 2 µg
RBG10179010 10 µg
RBG10179100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

I-309 is a CC chemokine that signals through the CCR8 receptor. It is secreted by T-lymphocytes, monocytes and mast cells. I-309 chemoattracts monocytes and Th2 differentiated T-cells, but not neutrophils. Human I-309 is active on murine cells. Recombinant human I-309 is an 8.5 kDa protein consisting of 74 amino acid residues that include six cysteine residues, of which four are the highly conserved cysteine residues present in CC chemokines. Unlike some CC chemokines, whose biologically active form in solution is a non-disulfide-linked dimer, the biologically active form of I-309 is monomeric.

Amino Acid Sequence

SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract total human T cell population using a concentration range of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation, Neural tissue markers

Related Products Docs