Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

I-TAC Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CXCL11, B-R1
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20082005 5 µg
RBG20082020 20 µg
RBG20082100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

I-TAC is a “non-ELR” CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2-activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, or monocytes. Recombinant Murine I-TAC is a 9.0 kDa protein containing 79 amino acid residues, including the four highly conserved cysteine residues present in CXC chemokines.

Amino Acid Sequence

FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract murine CXCR3-transfected HEK293 cells using a concentration range of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation, Animal studies

Related Products Docs