Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

IFN-ω Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Interferon alpha-II-1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10185020 20 µg
RBG10185100 100 μg
RBG10185250 250 µg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IFN-ω is a type I interferon that can be induced by virus-infected leukocytes. Members of the type I interferon family, which includes IFN-α, IFN-β, and IFN-ω, signal through the IFNAR-1/IFNAR-2 receptor complex, and exert antiviral and antiproliferative activities. IFN-ω exhibits about 75% sequence homology with IFN-α, and contains two conserved disulfide bonds that are necessary for full biological activity. Recombinant Human IFN-ω is a 19.9 kDa protein consisting of 172 amino acid residues.

Amino Acid Sequence

CDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS

Source

E. coli

Purity

98%

Biological Activity

The ED50 was determined by a cytotoxicity assay using Human TF-1 cells is 0.01 ng/ml, corresponding to a specific activity of 1×108 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules

Summary

IFNω belongs to class I interferon. In the human genome, the IFNω gene family consists of seven members located on chromosome 9. IFNω is a major component of human leukocyte IFN. Therapeutically administered IFNω may cause measurable serum concentrations in the corresponding patients. Monitoring of these IFNω serum levels provides an important tool in therapy.

Related Products Docs