Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

IFN-γ Rat E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Immune Interferon, T cell interferon, MAF, IFN-γ, Type II Interferon
  • Species:Rat
Please select your region to see available products and prices.
Cat. No. Size Price


RBG30061020 20 µg
RBG30061100 100 μg
RBG30061250 250 µg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IFN-γ is an acid-labile interferon produced by CD4 and CD8 T lymphocytes, as well as activated NK cells. IFN-γ receptors are present in most immune cells, which respond to IFN-γ signaling by increasing the surface expression of class I MHC proteins. This promotes the presentation of antigen to T-helper (CD4+) cells. IFN-γ signaling in antigen-presenting cells, and antigen-recognizing B and T lymphocytes, regulates the antigen-specific phases of the immune response. Additionally, IFN-γ stimulates a number of lymphoid cell functions, including the anti-microbial and anti-tumor responses of macrophages, NK cells, and neutrophils. Human IFN-γ is species-specific and is biologically active only in human and primate cells. Recombinant rat IFN-γ is a 15.6 kDa protein containing 135 amino acid residues.

Amino Acid Sequence

MQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Source

E. coli

Purity

98%

Biological Activity

The ED50 as determined by a cytopathic affect inhibition assay with murine L929 cells challenged with EMC virus was ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1×107 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in 10 mM Sodium Phosphate, pH 8.0 to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease, Cytokines and chemokines and related molecules, Diabetology - Other Relevant Products, Immune Response, Infection and Inflammation, Neural tissue markers, Oncology, Transplantation, Animal studies

Summary

IFNγ is a homodimeric glycoprotein containing approximately 21 to 24 kD subunits. Production of IFNg is a function of T cells and NK cells. IFNγ is produced during infection by T cells of the cytotoxic/sup­pressor phenotype (CD8) and by a subtype of helper T cells, the Th1 cells. IFNγ is a diagnostic tool for distinguishing tuberculous from other nontuberculous ascites. It is important in the design and monitoring of immunotherapy for multiple sclerosis.

Related Products Docs