Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

IFN-λ1 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL-29
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10183005 5 µg
RBG10183020 20 µg
RBG10183100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IFN λ1, 2, and 3 (also known as IL-29, IL-28A and IL-28B respectively) are distantly related to the IL-10 family and the interferons. All three IFN-lambdas use a distinct receptor system composed of an IFN-λR1 subunit (also called CRF2–12) and IL-10R2 subunit (also called CRF2–14). Signaling through this receptor system induces antiviral defenses similar to, but distinct from, that of type I interferons. Recombinant human IFN-λ1 is a 19.8 kDa protein containing 178 amino acid residues.

Amino Acid Sequence

PTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to activate STAT phosphorylation in an ISRE Luciferase Reporter Assay using human colon carcinoma COLO205 cells. The expected ED 50 is 0.2–0.5 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.5–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Immune Response, Infection and Inflammation

Related Products Docs