Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

IGF-1 E3R Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Insulin-Like Growth Factor-1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RD172604100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 77 AA. MW: 8.6 kDa (calculated). UniProtKB acc. no. P05019 (Gly49-Ala118). Point mutation E3R. C-terminal His-tag (6 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSAHHHHHH

Source

E. coli

Purity

Purity as determined by densitometric image analysis: >90%

Endotoxin

< 0.1 EU/μg

Applications

Western blotting, ELISA

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Growth hormone and factor-related products

Summary

IGF-1 (7649 Da) is a polypeptide protein hormone consisting of 70 amino acids. It is produced primilary by the liver as an endocrine hormone as well as target tissues in a paracrine/autocrine fashion. IGF-1 play a pivotal role in regulating the proliferation, differentiation and specific functions of many cell types

Related Products Docs