Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

IGF-BP1 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Insulin-like Growth Factor-Binding Protein 1, IBP-1, Placenta Protein 12 (PP12)
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10188005 5 µg
RBG10188025 25 µg
RBG10188100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IGF-BPs controls the distribution, function and activity of IGFs in various cell tissues and body fluids. Currently, there are seven named IGF-BPs that form high-affinity complexes with both IGF-I and IGF-II. IGF-BP1 is a 25.4 kDa, cysteine-rich, secreted protein expressed in the liver, deciduas, kidneys, and in amniotic fluid, where it is the most abundant IGF-BP. Levels of IGF-BP1 in serum are lowest after food consumption. IGF-BP1 binds to both IGF-I and IGF-II with equal affinity. Phosphorylated IGF-BP1 hinders IGF actions, whereas nonphosphorylated IGF-BP1 is stimulatory. Recombinant Human IGF-BP1 is a 25.4 kDa protein consisting of 235 amino acid residues (Isoform A).

Amino Acid Sequence

MAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

Source

E. coli

Purity

98%

Biological Activity

The ED 50 was determined by its ability to inhibit IGF-I induced proliferation of MCF-7 is 0.5 µg/ml in the presence of 6 ng/ml of human IGF-I.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Diabetology - Other Relevant Products, Oncology

Related Products Docs