Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

IGF-BP6 Human (BTI-Tn-5B1-4) Hi-5 Insect cells*

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:(BTI-Tn-5B1-4) Hi-5 Insect cells*
  • Other names:IBP-6
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10193005 5 µg
RBG10193020 20 µg
RBG10193100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IGF-BPs control the distribution, function and activity of IGFs in various cell tissues and body fluids. IGF-BP6, which specifically inhibits IGF-II actions, is produced by bone cells and is the major IGF-BP present in cerebrospinal fluid. IGF-BP6 has been shown to inhibit IGF-II-dependent cancers such as neuroblastoma, colon cancer and rhabdomyosarcoma. Recombinant Human IGF-BP6 has a calculated mass of 22.3 kDa and consists of 213 amino acid residues, including the IGF-BP domain and thyroglobulin type-I domain. Recombinant Human IGF-BP6 migrates at an apparent molecular weight of approximately 23.0–30.0 kDa by SDS-PAGE analysis under non-reducing conditions.

Amino Acid Sequence

RCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG

Source

(BTI-Tn-5B1-4) Hi-5 Insect cells*

Purity

95%

Biological Activity

Determined by its ability to inhibit IGF-II induced proliferation of human MCF-7 cells. The expected ED 50 for this effect is 0.1–0.4 µg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Diabetology - Other Relevant Products, Oncology

Related Products Docs