Type
Recombinant protein
Description
IL-1b is a proinflammatory cytokine produced in a variety of cells, including monocytes, tissue macrophages, keratinocytes, and other epithelial cells. Both IL-1a and IL-1b bind to the same receptor and have similar, if not identical, biological properties. These cytokines have a broad range of activities, including the stimulation of thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity, and, the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1b is a secreted cytokine, IL-1a is predominantly a cell-associated cytokine. Recombinant Rat IL-1b is a 17.4 kDa protein containing 153 amino acid residues.
Amino Acid Sequence
MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
Source
E. coli
Purity
98%
Biological Activity
The ED50 was determined by the dose-dependent stimulation of murine D10S cells is 0.1 ng/ml, corresponding to a specific activity of 1×107 units/mg.
Endotoxin
Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.
Storage/Expiration
–20°C