Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin - 1α Rat E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), Interleukin-1α
  • Species:Rat
Please select your region to see available products and prices.
Cat. No. Size Price


RBG30001A002 2 µg
RBG30001A010 10 µg
RBG30001A100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IL-1a is a non-secreted, proinflammatory cytokine produced in a variety of cells, including monocytes, tissue macrophages, keratinocytes, and other epithelial cells. Both IL-1a and IL-1b bind to the same receptor and have similar, if not identical, biological properties. These cytokines have a broad range of activities including the stimulation of thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity, and the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1b is a secreted cytokine, IL-1a is predominantly a cell-associated cytokine. Recombinant Rat IL-1a is a 17.7 kDa protein containing 155 amino acid residues.

Amino Acid Sequence

MAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS

Source

E. coli

Purity

98%

Biological Activity

The ED50 as determined by the dose-dependent proliferation of murine D10S cells is 0.005 ng/ml, corresponding to a specific activity of 2×108 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules, Diabetology - Other Relevant Products, Immune Response, Infection and Inflammation, Neural tissue markers, Oncology, Transplantation, Animal studies

Summary

IL-1α is predominantly a cell-associated, non-secreted proinflammatory cytokine. It is produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. High levels of IL-1α are associated with sepsis, rheumatoid arthritis, inflammatory bowel disease, acute and chronic myelogenous leukemia, insulin-dependent diabetes mellitus, and atherosclerosis.

Related Products Docs