Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-17 Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL-17, Interleukin-17A
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20017A005 5 µg
RBG20017A025 25 µg
RBG20017A100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

The originally described IL-17 protein, now known as IL-17A, is a disulfide linked homodimer, secreted by activated T cells that act on stromal cells to induce production of proinflammatory and hematopoietic bioactive molecules. Today, IL-17 represents a family of structurally-related cytokines that share a highly conserved C-terminal region but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. IL-17A exhibits cross-species bioactivity between human and murine cells. Recombinant murine IL-17A is a 30.0 kDa disulfide-linked homodimer of two 133 amino acid polypeptide chains.

Amino Acid Sequence

AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Source

E. coli

Purity

98%

Biological Activity

Measured by its ability to induce IL-6 production by NIH 3T3 cells.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules, Animal studies

Summary

Interleukin-17 is involved in the regulation of hematopoiesis and its effects are dependent on the physiological/pat­hological status of the organism. IL-17 expression in airways is upregulated upon allergen exposure such as in allergic asthma. Its crucial role in T-cell activation suggests that IL-17 is involved in the development of autoimmune arthritis.

Related Products Docs