Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-17B Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL20, NIRF
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10017B005 5 µg
RBG10017B025 25 µg
RBG10017B100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IL-17B is a disulfide-linked homodimer of two 161 amino acid polypeptide chains. It belongs to the IL-17 family of structurally-related cytokines that share a highly conserved C-terminal region, but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. IL-17B is expressed by T-cells, and has been shown to stimulate release of TNF-α and IL-1β from cells of the monocyte lineage. Recombinant Human IL-17B is a 36.6 kDa non-disulfide-linked homodimer of two 161 amino acid polypeptide chains.

Amino Acid Sequence

MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to induce IL-8 in human PBMCs using a concentration range of 10ng-100ng. Please Note: Results may vary with PBMC donors.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease, Immune Response, Infection and Inflammation

Related Products Docs