Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-19 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Melanoma differentiation association like protein
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10019002 2 µg
RBG10019010 10 µg
RBG10019100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IL-19 belongs to the IL-10 family of regulatory cytokines, which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine, because it up-regulates IL-6 and TNF-α, and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution, IL-19 exists predominantly as a non-disulfide-linked dimer.

Amino Acid Sequence

MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to activate STAT following receptor-ligand interaction.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in 10 mM Sodium Citrate, pH 3.0 to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease, Immune Response, Infection and Inflammation

Related Products Docs